PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca44840.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 551aa    MW: 61797.9 Da    PI: 4.645
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca44840.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM136.22.2e-42451772128
         NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiy......kvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                 ppGfrF+Ptdeelv++yL +kve+k+l+  + ++e+d+y      +++P++L    + ++++ewyfF+ rd+ky++gkr+nra   g+Wka+gkd+ ++
  Dca44840.1  45 PPGFRFEPTDEELVKYYLVPKVEKKELPP-NNMHEIDLYdpnngdEHNPQRLSeCYIPQGDREWYFFTLRDRKYQNGKRPNRASGGGFWKASGKDEVIT 142
                 9*************************888.668888877333444689****8557888999************************************* PP

         NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                 s++g+ +glkktLvfy  +  + +kt+W+mhe+rl
  Dca44840.1 143 SRDGTSIGLKKTLVFYCRTPTEVKKTNWIMHEFRL 177
                 ****************9999999**********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.45E-4742213IPR003441NAC domain
PROSITE profilePS5100546.20744214IPR003441NAC domain
PfamPF023652.9E-2645177IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 551 aa     Download sequence    Send to blast
MASSKGKEKV EETDNNNDNS NSNNQNNGNE NNNNRGTNVK LGPFPPGFRF EPTDEELVKY  60
YLVPKVEKKE LPPNNMHEID LYDPNNGDEH NPQRLSECYI PQGDREWYFF TLRDRKYQNG  120
KRPNRASGGG FWKASGKDEV ITSRDGTSIG LKKTLVFYCR TPTEVKKTNW IMHEFRLDVP  180
EDPPNKTHVK KNNDAPKPER VKLGTWVLCR IRYNTKGDKR VNVIKEEEEE EDDKSPKKAK  240
RESSSDNSPP KDVPSTSYGN VMMPIPAYYN AGHPSNTPMT ILPYNNVTDI PSTSNYTPVD  300
VKTNNGLFIA PNSNYTTEDA GMISDDCNFL EAIMSRNGDY PIDDNNFSWS ALTIQPQNTS  360
YLNQVPHWSQ AGPTNFIPSI SNPDITTTMA PPSMSYYPTD QNANWNYRGA TDVPSSSNST  420
PEDETQPSIG VNNNPTHASL PWSFQMEHLP STSRGIYDNN QITKPFTTEN PPAAPGTTTG  480
ATNADANVET GDKSGVAQSI DFKNPYDMDM DWNLSAQSPL PDFKIDFEDD PDFFDLIDLS  540
PPPPPLPPKP K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B7e-364421117162NAC domain-containing protein 19
4dul_A7e-364421117162NAC domain-containing protein 19
1ut7_B7e-364421117162NO APICAL MERISTEM PROTEIN
1ut7_A7e-364421117162NO APICAL MERISTEM PROTEIN
1ut4_B7e-364421117162NO APICAL MERISTEM PROTEIN
1ut4_A7e-364421117162NO APICAL MERISTEM PROTEIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08790.14e-41NAC family protein